PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016450793.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 297aa    MW: 32911.3 Da    PI: 10.3218
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016450793.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.81.2e-13120164347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++ + ++lG+g+W+ I+r + ++Rt+ q+ s+ qky
   XP_016450793.1 120 PWTEEEHRIFLIGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKY 164
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.394113169IPR017930Myb domain
SuperFamilySSF466897.48E-18115170IPR009057Homeodomain-like
TIGRFAMsTIGR015575.4E-18116168IPR006447Myb domain, plants
SMARTSM007174.4E-10117167IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-11117163IPR009057Homeodomain-like
PfamPF002495.7E-11120164IPR001005SANT/Myb domain
CDDcd001674.74E-9120165No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MGRKCSHCGI TGHNSRTCKS QKAKIDEKKE DAITSNIGMK LFGVKLEIPK SSSFASSASM  60
KKSFSVGCLL NSSKISSSTV GSFASNCEMF SDENLDYKVS NGYLSDELVG RTLDKKKGVP  120
WTEEEHRIFL IGLEKLGKGD WRGISRNFVT TRTPTQVASH AQKYFLRQNS LNRTKRRRSL  180
FDKVGMDKST ILLFDKRVTK TKESTSISYE KSAQHGETNI SMINFSTSSS KDSKSNSQQY  240
SMPATVVNLP FINSSDYISI QDSLNPDLDL TLAAPRQLNN QRRKSSGPLA GNTITVV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009780709.10.0PREDICTED: myb-like protein H isoform X1
RefseqXP_016450793.10.0PREDICTED: myb-like protein H isoform X1
TrEMBLK4CLB83e-98K4CLB8_SOLLC; Uncharacterized protein
STRINGSolyc08g065380.2.18e-98(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA33852147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.12e-49MYB_related family protein